Scaffold BLZ4_1070735

Overview

Basic Information

• Taxon OID: 3300003317
• Scaffold ID: BLZ4_1070735
• Source Dataset Name: Belize BBD 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 690
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location

• Location Name: Belize: Carrie Bow Cay Field Station
• Coordinates
  • Lat. (^o): 16.80288
  • Long. (^o): -88.08213

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051950	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
BLZ4_10707351	F051950	N/A	MWGYISTEAIYQLNFNVGFSTTRSDVLVHLSQ*QY***F*FAFL*SFYYLFSARVVRYRALKMRPRIVTSFRPHGKWGDFLAATIPAI*CLNILANSNFILRLIEWQNEASLFTVRVRARQ*Y*VYKFELKNFTDILTAPKNIGYNR*SVNTFGDLQVAEDYLYVLQLRSQNS*VKNY*SEV