Scaffold BLZ4_1000114

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BLZ4_1000114

Scaffold BLZ4_1000114

Overview

Basic Information
Taxon OID	3300003317 Open in IMG/M
Scaffold ID	BLZ4_1000114 Open in IMG/M
Source Dataset Name	Belize BBD 4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	31319
Total Scaffold Genes	49 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (20.41%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease

Source Dataset Sampling Location
Location Name	Belize: Carrie Bow Cay Field Station
Coordinates	Lat. (^o)	16.80288	Long. (^o)	-88.08213	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001506	Metagenome / Metatranscriptome	681	Y

Sequences

Protein ID	Family	RBS	Sequence
BLZ4_100011413	F001506	N/A	MTRILYEIRCKSKEEVSITKKRKPSTRSEGKPFLYPNINEITAKTFQIKYDKKLSSIAKMVLNNCHKKYFYYAIDDILYLFKSNPIERDNILSILYSPVLSLQNNLSINFFDIWIHEIYISEISKVNKFLTKNEQTQNGEQVSYITIKLLYRTKIPIKKQKFLW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.