NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold P22013IDBA_10022244

Scaffold P22013IDBA_10022244


Overview

Basic Information
Taxon OID3300003315 Open in IMG/M
Scaffold IDP22013IDBA_10022244 Open in IMG/M
Source Dataset NameOre pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Campinas
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2505
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine

Source Dataset Sampling Location
Location NameMina do Sossego, Brazil
CoordinatesLat. (o)-6.426389Long. (o)-50.051389Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035205Metagenome172Y

Sequences

Protein IDFamilyRBSSequence
P22013IDBA_100222446F035205GGAVNPTFVLTVAGFQVLVWADALLNDGRFGGNWRTALAGLGLIGMAAATWWVGTSVTRRGIVIHAVPTLMIPWDEVHEIEVEHQLGIKTVVVHHGGTIRRRTRLSAPTTGPLGRDEQFQEKVRVLRSYWAAQRSGQAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.