| Basic Information | |
|---|---|
| Taxon OID | 3300003315 Open in IMG/M |
| Scaffold ID | P22013IDBA_10000771 Open in IMG/M |
| Source Dataset Name | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Campinas |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21993 |
| Total Scaffold Genes | 25 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (52.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mina do Sossego, Brazil | |||||||
| Coordinates | Lat. (o) | -6.426389 | Long. (o) | -50.051389 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002818 | Metagenome | 528 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| P22013IDBA_1000077125 | F002818 | N/A | MPTEVETLRELARAFWGNRPLLCPRHPSSALTGSFVQTTFADHIALVCAHGKETLTIPQRPKQTEFQAQQVEGMVENLQRGDAILCYRCQARVEIDAKPNRESGITDYTFTCTRCLSWGRWVGKPELAKIGS* |
| ⦗Top⦘ |