NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold P32013IDBA_1028219

Scaffold P32013IDBA_1028219


Overview

Basic Information
Taxon OID3300003313 Open in IMG/M
Scaffold IDP32013IDBA_1028219 Open in IMG/M
Source Dataset NameOre pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Campinas
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1875
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine

Source Dataset Sampling Location
Location NameMina do Sossego, Brazil
CoordinatesLat. (o)-6.426389Long. (o)-50.051389Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003345Metagenome / Metatranscriptome493Y

Sequences

Protein IDFamilyRBSSequence
P32013IDBA_10282192F003345GGGGGMRNQVKTARPAARKGSGSRAKKTVAVPSRKSQPIIQMVERKSSPNITELPKKHGELPIPTATFVF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.