Basic Information | |
---|---|
Taxon OID | 3300003312 Open in IMG/M |
Scaffold ID | P12013IDBA_1074575 Open in IMG/M |
Source Dataset Name | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Campinas |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 669 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil → Ore Pile And Mine Drainage Contaminated Soil Microbial Communities From Mina Do Sossego, Brazil, In A Copper Mine |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mina do Sossego, Brazil | |||||||
Coordinates | Lat. (o) | -6.426389 | Long. (o) | -50.051389 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036482 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P12013IDBA_10745752 | F036482 | N/A | LPAAELAEVLTQAGFSDVRFHDRFDCFGGTSKERTARKYGVIGINISAMRSGG* |
⦗Top⦘ |