| Basic Information | |
|---|---|
| Taxon OID | 3300003308 Open in IMG/M |
| Scaffold ID | Ga0006777J48905_1016720 Open in IMG/M |
| Source Dataset Name | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1297 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae → unclassified Fiersviridae → Leviviridae sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hopland, California, USA | |||||||
| Coordinates | Lat. (o) | 38.97364 | Long. (o) | -123.117453 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019936 | Metagenome / Metatranscriptome | 226 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0006777J48905_10167201 | F019936 | AGGAG | MAFTDPLSITISGTTTPLPRISVMEDESIYQSNDGLIQVQASHDSGKRYRHLLRVNHSKLAPDPFRPTENVKVSMSHYIVFDVPVAGYSATEQIAVYTGFKTMYSAATDALITKLLGGES |
| ⦗Top⦘ |