Scaffold Ga0006243J48910_1004785

Overview

Basic Information

• Taxon OID: 3300003302
• Scaffold ID: Ga0006243J48910_1004785
• Source Dataset Name: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C49A8_35 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2648
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 35.7899
  • Long. (^o): -122.3199

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048633	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0006243J48910_10047854	F048633	AGCAGG	MDINIGDNNMPMKKAMPGGKITNKGKYKHGGKVHRNKKGHGGVMTIVLKKDKTKKK*