Scaffold Ga0006245J48900_105749

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0006245J48900_105749

Scaffold Ga0006245J48900_105749

Overview

Basic Information
Taxon OID	3300003294 Open in IMG/M
Scaffold ID	Ga0006245J48900_105749 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_35 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	532
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	35.7899	Long. (^o)	-122.3199	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009426	Metagenome / Metatranscriptome	318	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006245J48900_1057491	F009426	N/A	LKVKLKNANFSTATKVNKNVKLLLNMTFSEILYTIIFFMTTSPCVISAGAARETLFEGKADYCMIVCE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.