Scaffold soilL1_10047462

Overview

Basic Information

• Taxon OID: 3300003267
• Scaffold ID: soilL1_10047462
• Source Dataset Name: Sugarcane bulk soil Sample L1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2234
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia

Source Dataset Sampling Location

• Location Name: Ayr, Queensland Australia
• Coordinates
  • Lat. (^o): -19.733298
  • Long. (^o): 147.17873

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032030	Metagenome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
soilL1_100474621	F032030	N/A	MNGGSESARKLLAEAVAGPNVVILEDASSRSDVAFCRVVRGRWIRGESNKPPAFVVLIDFTDFHQLSGDAEARAAFDVGWGLLHEIDHVVRDSEDARDAKGVGDCEDHINRMRLEVGLPVRVDYFFSRAYLKADSNFNARYVRLSFERRAKRYWLVWDATTVGGLVGDSQRALVR*