Scaffold JGI26118J46590_1045784

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI26118J46590_1045784

Scaffold JGI26118J46590_1045784

Overview

Basic Information
Taxon OID	3300003265 Open in IMG/M
Scaffold ID	JGI26118J46590_1045784 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	36.25	Long. (^o)	-122.2099	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047764	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26118J46590_10457841	F047764	N/A	QMLKLKFNQNFKTIQLILNQSISIKIYKKYILINSKDLEKIEKILDSQYLKYKII*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.