NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26117J46588_1006011

Scaffold JGI26117J46588_1006011


Overview

Basic Information
Taxon OID3300003263 Open in IMG/M
Scaffold IDJGI26117J46588_1006011 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1131
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameMonterey Bay, California, USA
CoordinatesLat. (o)36.25Long. (o)-122.2099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014724Metagenome / Metatranscriptome260Y
F044418Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
JGI26117J46588_10060112F044418N/AMSHEQRMIDYAQKWYEANDLETEKKNGNDLYLRVNDNVFTEVSHCDIRQKAMLWLESELEGVMYS*
JGI26117J46588_10060114F014724AGGAGGMKEELKAIKYAVDGLSDELLEHRRYANMDDLVKVMKSINENLCSVTFALEDLVKEKRMQNELTVQLK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.