NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25406J46586_10197824

Scaffold JGI25406J46586_10197824


Overview

Basic Information
Taxon OID3300003203 Open in IMG/M
Scaffold IDJGI25406J46586_10197824 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)587
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038292Metagenome166Y

Sequences

Protein IDFamilyRBSSequence
JGI25406J46586_101978241F038292N/AVSTQLFSEHLGQRIALAGLLIYVVFAPHSVAASAIGVAIAGIGWIVRSVATRSLGLGRSRFDLVIVLSLVWTALSSFLSAEPAISIAKLQASWSVFLFY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.