Scaffold Ga0006778J45830_1089805

Overview

Basic Information

• Taxon OID: 3300003162
• Scaffold ID: Ga0006778J45830_1089805
• Source Dataset Name: Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 784
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.97364
  • Long. (^o): -123.117453
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070177	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0006778J45830_10898051	F070177	AGG	VADEITLTIPREPDFHRVAHLVLGGLAVRLNLTVENLEDLEIALDSILDRSEVDAGDITVHMAVRDGALETRVGPLGTRFWTRSSASATRT*