| Basic Information | |
|---|---|
| Taxon OID | 3300003154 Open in IMG/M |
| Scaffold ID | Ga0052186_10090345 Open in IMG/M |
| Source Dataset Name | Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cells |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1362 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium HGW-Tenericutes-7 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor → Bioreactor Microbial Community From Anode Biofilm In Microbial Fuel Cells |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007838 | Metagenome / Metatranscriptome | 344 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052186_100903452 | F007838 | N/A | MRTLYVFLLLILNSEIFGQIPAGLTMVVKNPTWQAEDAAKESLEKADRIRQITTLTEQVNTQKESLQAIRDATEKLRKINRKVANYHNLELAVVQVSDSYSRVLNSLKTISDHNCFKPSEYHMISESMMGLLSQTSYAITTLTVVLTDNFSEMSDGERLLNMNQAIKELRENLGVINSAIIEVEILDNQRMQLRTLNYINSIFK* |
| ⦗Top⦘ |