Scaffold Ga0052186_10078516

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052186_10078516

Scaffold Ga0052186_10078516

Overview

Basic Information
Taxon OID	3300003154 Open in IMG/M
Scaffold ID	Ga0052186_10078516 Open in IMG/M
Source Dataset Name	Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cells
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2601
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor → Bioreactor Microbial Community From Anode Biofilm In Microbial Fuel Cells

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052186_100785163	F079376	GAG	MSDIMTTREPGRPCASLGTKRVCRTTEEGGRQMRPRESDSLIVPVKAGNAAGGKEATHGSAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.