Scaffold Ga0052192_1211782

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052192_1211782

Scaffold Ga0052192_1211782

Overview

Basic Information
Taxon OID	3300003153 Open in IMG/M
Scaffold ID	Ga0052192_1211782 Open in IMG/M
Source Dataset Name	Marine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	637
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From Deep-sea Hydrothermal Vent Plumes In The Guaymas Basin

Source Dataset Sampling Location
Location Name	Guaymas Basin, Gulf of mexico
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023718	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052192_12117822	F023718	N/A	MKYIMEFDLSLNRSLEELIASYWEAENEGIESSAFYALEDYLSGMGAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.