| Basic Information | |
|---|---|
| Taxon OID | 3300003153 Open in IMG/M |
| Scaffold ID | Ga0052192_1152875 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 547 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From Deep-sea Hydrothermal Vent Plumes In The Guaymas Basin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymas Basin, Gulf of mexico | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012279 | Metagenome / Metatranscriptome | 282 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052192_11528751 | F012279 | GAG | MTVIENRLSELRDTVRTLETVETTLESLRETKWTLVKELRELGHDFKATTEGMDIVLSSSPSMNWN* |
| ⦗Top⦘ |