Basic Information | |
---|---|
Taxon OID | 3300003153 Open in IMG/M |
Scaffold ID | Ga0052192_1065999 Open in IMG/M |
Source Dataset Name | Marine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From Deep-sea Hydrothermal Vent Plumes In The Guaymas Basin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guaymas Basin, Gulf of mexico | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105355 | Metagenome / Metatranscriptome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052192_10659991 | F105355 | AGAAGG | MEELNSCDSSDKLTLLLNIRQGTQSTTYSVSNLPDWYDMLGIFAIYGIVAMTIFYSGLWIASRFITNKE* |
⦗Top⦘ |