NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052192_1060833

Scaffold Ga0052192_1060833


Overview

Basic Information
Taxon OID3300003153 Open in IMG/M
Scaffold IDGa0052192_1060833 Open in IMG/M
Source Dataset NameMarine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas Basin
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)562
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From Deep-sea Hydrothermal Vent Plumes In The Guaymas Basin

Source Dataset Sampling Location
Location NameGuaymas Basin, Gulf of mexico
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036421Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0052192_10608333F036421N/ADLAHDATDAIATFDVTWSYKKWNPFKMGNLGNRSQVNLAIGEFRNEKDGFPFLEDLPPELSGPLTGAVNQGINTGPLSKASNLFG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.