NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052254_1012165

Scaffold Ga0052254_1012165


Overview

Basic Information
Taxon OID3300003152 Open in IMG/M
Scaffold IDGa0052254_1012165 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Loktak Lake, India
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Environmental Engineering Research Institute, India
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)767
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Microbial Communities From Loktak Lake India

Source Dataset Sampling Location
Location NameILoktak Lake, Imphal, India
CoordinatesLat. (o)24.562571Long. (o)93.815303Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004467Metagenome / Metatranscriptome437Y

Sequences

Protein IDFamilyRBSSequence
Ga0052254_10121652F004467N/AGREDRWTFARGDGAVPDVLIATAARLGDTHPGDTVVIVVGSSSQAMHRVVGSVAVSLARHAEVPVVIVP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.