| Basic Information | |
|---|---|
| Taxon OID | 3300003152 Open in IMG/M |
| Scaffold ID | Ga0052254_1007447 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Loktak Lake, India |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Environmental Engineering Research Institute, India |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1218 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Microbial Communities From Loktak Lake India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ILoktak Lake, Imphal, India | |||||||
| Coordinates | Lat. (o) | 24.562571 | Long. (o) | 93.815303 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002749 | Metagenome / Metatranscriptome | 533 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052254_10074472 | F002749 | GGAGG | VHTNLVVIFNFIISQWSLSPQAFKDAVLYAALFKSVLAVLWWTMRVLVRKFPASEAASGLQVLLTNRVAKLVVLVLDVTLIDVFLFFAGVALLDLCRGFSIFSLWTAALFSFLLAYMVLVAHWDIKRYWTRC* |
| ⦗Top⦘ |