Scaffold Ga0052234_1110517

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052234_1110517

Scaffold Ga0052234_1110517

Overview

Basic Information
Taxon OID	3300003149 Open in IMG/M
Scaffold ID	Ga0052234_1110517 Open in IMG/M
Source Dataset Name	Marine microbial communities from Baltimore Inner Harbor, Chesapeake Bay - harmful algal bloom
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	613
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location
Location Name	Baltimore Inner Harbour, Chesapeake Bay
Coordinates	Lat. (^o)	39.283	Long. (^o)	-76.611	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008804	Metatranscriptome	327	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052234_11105171	F008804	N/A	HSEGRDERTKIPITFNSISQRKATRAMGSNEYATEKQLYEQGIEVPTTKRWQITNRYRGLQCDGIHTDMRARDPLYYDMPCPMGEQAYGQSTYCAWVEPFKKELNSVCPYAFGLDDLVLQSGLYSMCAAHEKPFCYSYTEHIR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.