Scaffold Ga0052234_1101941

Overview

Basic Information

• Taxon OID: 3300003149
• Scaffold ID: Ga0052234_1101941
• Source Dataset Name: Marine microbial communities from Baltimore Inner Harbor, Chesapeake Bay - harmful algal bloom
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1203
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location

• Location Name: Baltimore Inner Harbour, Chesapeake Bay
• Coordinates
  • Lat. (^o): 39.283
  • Long. (^o): -76.611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096543	Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0052234_11019411	F096543	N/A	SVQNRILPVQLTDHLCRQSPFLDAMATKVLIALASPVLAAAIVLKAEENATKAKSGSCDCMTWSDVYYTNKAVCGRANELYFLSKTGFSASYADTEPITGLPHKICYDFFKNFASPACVNIDLVPFPADEFSGQQWCYVSNDCANLNGGGYATNIEGFSQSSWHNLQSASQQAWKICDPTESDTPALSVKLVPEVVALGVESDVSLSQLLKLAYPAVNISWGEASLLWQAIDAAYEPGRTVTEMVDAVPELTGWGSEVVDRRLRAIAKSEQGTVLDSPGHGDIYHVVQGRAAYVVRRAADGNMAYLGGHFSQEYTVSCVIGCADAEPRNALDLSTL*