Scaffold Ga0052234_1000495

Overview

Basic Information

• Taxon OID: 3300003149
• Scaffold ID: Ga0052234_1000495
• Source Dataset Name: Marine microbial communities from Baltimore Inner Harbor, Chesapeake Bay - harmful algal bloom
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 840
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location

• Location Name: Baltimore Inner Harbour, Chesapeake Bay
• Coordinates
  • Lat. (^o): 39.283
  • Long. (^o): -76.611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073043	Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052234_10004951	F073043	GAG	MMELDHFIMWAHHVWTDPVSRRIVRAWKPFNGLQLYDPEAWVDEIVGDADSLFEAPPAFCKKGAARVRINCDDDGNYHPKKSEGLEFLKEAMEKAVRQVTV*