| Basic Information | |
|---|---|
| Taxon OID | 3300003148 Open in IMG/M |
| Scaffold ID | Ga0052262_1114400 Open in IMG/M |
| Source Dataset Name | Algal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 572 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltimore Inner Harbour, Chesapeake Bay, Maryland, USA | |||||||
| Coordinates | Lat. (o) | 39.283 | Long. (o) | -76.611 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035313 | Metatranscriptome | 172 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052262_11144001 | F035313 | N/A | GVFFDTLWVAASAVPSRAAFAMAALEVPDGVELNGCEDEFDAKEAEKSGRFSKDDPLQEHYKKTGWMGGLTGMFGDKKTMWCHHMTSAGEPAVRSAKSAGKSFKTVEEVWQFLDKKPCCGRYAYDRKKGSLICGPCIKADHDKTCNRDTCLFIASGLECPVPTDALKE* |
| ⦗Top⦘ |