Scaffold Ga0052262_1109025

Overview

Basic Information

• Taxon OID: 3300003148
• Scaffold ID: Ga0052262_1109025
• Source Dataset Name: Algal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1158
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location

• Location Name: Baltimore Inner Harbour, Chesapeake Bay, Maryland, USA
• Coordinates
  • Lat. (^o): 39.283
  • Long. (^o): -76.611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058569	Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052262_11090251	F058569	N/A	ASILQGAIIDNRPPWGSQNSNQEPLLARYKRSQDSTGVVKVKTVDYANMSTLMTRFFSSGEGEINLNARTNNMLGVTHELTSLAAHAHLDSPTNVTKLDEKAKAARLLGMLNFLELCADAEADVDLCVYVEPTTFVHRTNETGVVEQAVKLFRQNPQTVVLLPPDMCVSTKTTGNGVCKAGNVTSGGINHGFFVVNRDRFEGFAPMPVESLGLDSVLEDLLAEGLTKGGVEGPVKQIRCGGAFAIHPFDSSLGKYACQPQRQLGLSAHSQAATGRAASARDAGIYSEDYSRFPGGGMRAKGLASLIERFEAGKFPEAKPMDSLTNKCNNMCPSKERVRDGLAW*