Scaffold Ga0052262_1100936

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052262_1100936

Scaffold Ga0052262_1100936

Overview

Basic Information
Taxon OID	3300003148 Open in IMG/M
Scaffold ID	Ga0052262_1100936 Open in IMG/M
Source Dataset Name	Algal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	564
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location
Location Name	Baltimore Inner Harbour, Chesapeake Bay, Maryland, USA
Coordinates	Lat. (^o)	39.283	Long. (^o)	-76.611	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078170	Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052262_11009361	F078170	N/A	SSFTKCVANATKAKSEAGLANMLFNRQRLIAALPLSVNADDLDLVTGFDQALLAGLSGSGAIKGMQCGHSFVIRPSGEEAKCQGKKMPLKTHLLAAGKTKDSDASRFSGEYGVFNQRMVMGFEVVVDRVEKGMIPAPTGSVGDKCLEMCPSSDRINQGLAW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.