Scaffold Ga0052262_1049294

Overview

Basic Information

• Taxon OID: 3300003148
• Scaffold ID: Ga0052262_1049294
• Source Dataset Name: Algal bloom microbial communities from Baltimore Inner Harbor, Chesapeake Bay
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 706
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities Of A Harmful Algal Bloom From Baltimore Inner Harbor

Source Dataset Sampling Location

• Location Name: Baltimore Inner Harbour, Chesapeake Bay, Maryland, USA
• Coordinates
  • Lat. (^o): 39.283
  • Long. (^o): -76.611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051939	Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052262_10492941	F051939	N/A	GPMLRPCAGSPEQSEFSRVLKARDKLHLDQVRELQPPQDANLDLRHIATLWKLDADHDGGVTFQELLDFAEFCNERKRIVGDLDFLSKLKAQCDVELWDVIKDEQGRDLFADWVVLLVLQGDSFFTFAASPSVRFASRDTVMTLYDLLQPYQISSHIDQQGFLDMMQQIGENMGLMSLQVEELDDWVPVEVVKNWVKSFIAAYANLFRELDLQPPRAVHEDELAMAAGSTCSPP