| Basic Information | |
|---|---|
| Taxon OID | 3300003147 Open in IMG/M |
| Scaffold ID | Ga0052235_1036117 Open in IMG/M |
| Source Dataset Name | Planktonic microbial communities from North Pacific Subtropical Gyre |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1504 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Subtropical Gyre, Hawaii | |||||||
| Coordinates | Lat. (o) | 22.887959 | Long. (o) | -158.027466 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005749 | Metagenome | 391 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052235_10361173 | F005749 | AGGAG | MKKSWLLIMSFDEHDGSPNDIKTLYHGKTKHGMVKTMDLFQDMNEHLVLTLVEIDKKSTYDKIIDKEDSEEMFFMDSKRNWNNEKTYEDLKEEVLEEMLMGSLINGDMGYA* |
| ⦗Top⦘ |