Scaffold Ga0052235_1022446

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052235_1022446

Scaffold Ga0052235_1022446

Overview

Basic Information
Taxon OID	3300003147 Open in IMG/M
Scaffold ID	Ga0052235_1022446 Open in IMG/M
Source Dataset Name	Planktonic microbial communities from North Pacific Subtropical Gyre
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	710
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location Name	North Pacific Subtropical Gyre, Hawaii
Coordinates	Lat. (^o)	22.887959	Long. (^o)	-158.027466	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076188	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0052235_10224461	F076188	GAGG	MSDVRKVLILDHRDIKTLAKHKYAELAYTTDAMLDLWNEIVDQILEQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.