| Basic Information | |
|---|---|
| Taxon OID | 3300003142 Open in IMG/M |
| Scaffold ID | Ga0052242_1019332 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Japan Agency for Marine-Earth Science and Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 885 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Deep Subseafloor |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Northwestern Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 41.1773 | Long. (o) | 142.2013 | Alt. (m) | Depth (m) | 1180.5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022812 | Metagenome / Metatranscriptome | 212 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052242_10193322 | F022812 | N/A | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLFDVTLQSWCFSIR |
| ⦗Top⦘ |