| Basic Information | |
|---|---|
| Taxon OID | 3300003129 Open in IMG/M |
| Scaffold ID | Ga0052190_105315 Open in IMG/M |
| Source Dataset Name | Olavius algarvensis microbial community from off the coast of Capo di Sant Andrea, Elba, Italy |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI), Max Planck Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1083 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Integument → Unclassified → Unclassified → Olavius Algarvensis → Olavius Algarvensis Microbial Communities From Capo Di Sant'Andrea Bay, Elba, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bay off Capo di Sant'Andrea, Elba, Italy | |||||||
| Coordinates | Lat. (o) | 42.807222 | Long. (o) | 10.141111 | Alt. (m) | Depth (m) | 5.6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000089 | Metagenome | 2423 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052190_1053151 | F000089 | N/A | MWVRGHSRSLKLVPFESLDAVSYSPSIVTVAVSVAVCEIFSVKEWRDLENQVRGRSRSLKMAPFDRPYATF* |
| ⦗Top⦘ |