NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0052190_104530

Scaffold Ga0052190_104530


Overview

Basic Information
Taxon OID3300003129 Open in IMG/M
Scaffold IDGa0052190_104530 Open in IMG/M
Source Dataset NameOlavius algarvensis microbial community from off the coast of Capo di Sant Andrea, Elba, Italy
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI), Max Planck Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2373
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Integument → Unclassified → Unclassified → Olavius Algarvensis → Olavius Algarvensis Microbial Communities From Capo Di Sant'Andrea Bay, Elba, Italy

Source Dataset Sampling Location
Location NameBay off Capo di Sant'Andrea, Elba, Italy
CoordinatesLat. (o)42.807222Long. (o)10.141111Alt. (m)Depth (m)5.6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F106038Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0052190_1045304F106038N/AVSVVYGTTANVAGAAIRNFRIGPSLSNRIESGRPIRIRIESGSFACPDQKATYAACKPLFLAVTEI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.