Scaffold Ga0052190_104530

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052190_104530

Scaffold Ga0052190_104530

Overview

Basic Information
Taxon OID	3300003129 Open in IMG/M
Scaffold ID	Ga0052190_104530 Open in IMG/M
Source Dataset Name	Olavius algarvensis microbial community from off the coast of Capo di Sant Andrea, Elba, Italy
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI), Max Planck Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2373
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (16.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Integument → Unclassified → Unclassified → Olavius Algarvensis → Olavius Algarvensis Microbial Communities From Capo Di Sant'Andrea Bay, Elba, Italy

Source Dataset Sampling Location
Location Name	Bay off Capo di Sant'Andrea, Elba, Italy
Coordinates	Lat. (^o)	42.807222	Long. (^o)	10.141111	Alt. (m)		Depth (m)	5.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106038	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052190_1045304	F106038	N/A	VSVVYGTTANVAGAAIRNFRIGPSLSNRIESGRPIRIRIESGSFACPDQKATYAACKPLFLAVTEI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.