| Basic Information | |
|---|---|
| Taxon OID | 3300003128 Open in IMG/M |
| Scaffold ID | Ga0052265_110637 Open in IMG/M |
| Source Dataset Name | Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute of Catalysis, The Higher Council for Scientific Research (CSIC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1056 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Vally of Mogao stream, Los Rueldos site, NW Spain | |||||||
| Coordinates | Lat. (o) | 43.25 | Long. (o) | -5.7666667 | Alt. (m) | Depth (m) | .03 to .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013397 | Metagenome / Metatranscriptome | 271 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052265_1106372 | F013397 | GGAG | MTSIAATLGIRERLRQRVLPHHEAWRRQDEYAGGCLCDGCGERSTSARASYEVDFSPDVTPQSVKLHRARVKIWQYEGESPPIS* |
| ⦗Top⦘ |