Scaffold Ga0052266_101312

Overview

Basic Information

• Taxon OID: 3300003127
• Scaffold ID: Ga0052266_101312
• Source Dataset Name: Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3213
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain

Source Dataset Sampling Location

• Location Name: Vally of Mogao stream, Los Rueldos site, NW Spain
• Coordinates
  • Lat. (^o): 43.25
  • Long. (^o): -5.7666667
  • Depth (m): .03 to .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026917	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052266_1013121	F026917	AGGAGG	MTELDAAARQILEKVRMFLADETRFGVLSSGERIAVAVVLDRHDLIQRAWGTIAEAVDRLGPTWTAAALRVQRNGWQEDATE*