| Basic Information | |
|---|---|
| Taxon OID | 3300003123 Open in IMG/M |
| Scaffold ID | Ga0052188_101108 Open in IMG/M |
| Source Dataset Name | Hypersaline anoxic lake microbial communities from Lake Thetis, Australia |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2296 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Thetis, Australia | |||||||
| Coordinates | Lat. (o) | -30.506732 | Long. (o) | 115.081428 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056324 | Metagenome / Metatranscriptome | 137 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052188_1011084 | F056324 | AGGAG | MKGKLVITLMVLTLIAGLSGCAGSKIYLIDVKYLAEKKLPPTLKVVGVCTFEDARKGRGGDTIGVRHRPGKHVDLLKLEEVNLSEVTTQAVKDYFTDNGFQVTDCKGWNMSPEGLDRLPKDLSLVVGGKIDSFMVEAKSGITTTTDIQYIVKIEALIGQMEDRKVIIRTRKSASKSKEMGFDPGKVKDELNSILTEVIQNLFK* |
| ⦗Top⦘ |