Scaffold Ga0052188_101108

Overview

Basic Information

• Taxon OID: 3300003123
• Scaffold ID: Ga0052188_101108
• Source Dataset Name: Hypersaline anoxic lake microbial communities from Lake Thetis, Australia
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2296
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Saline Anoxic Brine Of The Deep-Sea Hypersaline Anoxic Lake (Dhal) Thetis

Source Dataset Sampling Location

• Location Name: Lake Thetis, Australia
• Coordinates
  • Lat. (^o): -30.506732
  • Long. (^o): 115.081428

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056324	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052188_1011084	F056324	AGGAG	MKGKLVITLMVLTLIAGLSGCAGSKIYLIDVKYLAEKKLPPTLKVVGVCTFEDARKGRGGDTIGVRHRPGKHVDLLKLEEVNLSEVTTQAVKDYFTDNGFQVTDCKGWNMSPEGLDRLPKDLSLVVGGKIDSFMVEAKSGITTTTDIQYIVKIEALIGQMEDRKVIIRTRKSASKSKEMGFDPGKVKDELNSILTEVIQNLFK*