Scaffold Ga0052267_104590

Overview

Basic Information

• Taxon OID: 3300003115
• Scaffold ID: Ga0052267_104590
• Source Dataset Name: Acid mine drainage microbial communities from Los Rueldos abandoned mercury mine in Spain - Sample B2A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 939
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain

Source Dataset Sampling Location

• Location Name: Mogao stream, Los Rueldos, Spain
• Coordinates
  • Lat. (^o): 43.25
  • Long. (^o): -5.7666667
  • Depth (m): .03 to .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063194	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052267_1045901	F063194	N/A	SLTQQYASLNVLLSQLQTTSSYLTQAFAALPNAPKGTSSGG*