Scaffold Ga0052187_10046

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0052187_10046

Scaffold Ga0052187_10046

Overview

Basic Information
Taxon OID	3300003086 Open in IMG/M
Scaffold ID	Ga0052187_10046 Open in IMG/M
Source Dataset Name	Marine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	50322
Total Scaffold Genes	32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	27 (84.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Lau and Guaymas Basin
Coordinates	Lat. (^o)	-20.053234	Long. (^o)	-176.133763	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105866	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0052187_1004610	F105866	GAGG	MATEDTGFTQIPYVRKDDTFKEWRERTNLMIQQQNNFVRMQEFDMLGVSDVWVKTSMQLNYSGETEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.