| Basic Information | |
|---|---|
| Taxon OID | 3300003084 Open in IMG/M |
| Scaffold ID | Ga0051102_10899 Open in IMG/M |
| Source Dataset Name | Marine pico-prymnesiophytes microbial communities from Florida Straits, Gulf of Mexico, Atlantic Ocean |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5083 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Pico-Prymnesiophytes → Marine Pico-Prymnesiophytes Phytoplankton Communities From Florida Straits, Gulf Of Mexico, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Florida Straits, Gulf of Mexico, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 23.359462 | Long. (o) | -82.379192 | Alt. (m) | Depth (m) | 75 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024700 | Metagenome / Metatranscriptome | 204 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0051102_108993 | F024700 | AGG | MPKGPAKATGLYAEMDLTGVVSTLESHWVVLDAELSEIRKDFASLRTLTRKHGDFWSRPMAQLKKLRTQKENLLKEIKFQMELFNLHIQQGRDLCSKLSSVASVIKTPPAQLQSQLAIEVVSPILANSQNPLSVAREPL* |
| ⦗Top⦘ |