| Basic Information | |
|---|---|
| Taxon OID | 3300002966 Open in IMG/M |
| Scaffold ID | JGI24721J44947_10183274 Open in IMG/M |
| Source Dataset Name | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1111 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.611006 | Long. (o) | -110.440182 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069685 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24721J44947_101832742 | F069685 | N/A | MSEEKLTANVETLRARIAELDAENEKLKAAMTAATKTLTVYVERERETAIKSIMEKSTFSKEELEKLDLTPLKLIEKGIDNVKGTVKSVRSAAAAPCADDSKLTVGCLLLQEGA* |
| ⦗Top⦘ |