| Basic Information | |
|---|---|
| Taxon OID | 3300002965 Open in IMG/M |
| Scaffold ID | JGI26063J44948_1027366 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1222 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -37.9728 | Long. (o) | -44.9905 | Alt. (m) | Depth (m) | 2502 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023452 | Metagenome / Metatranscriptome | 210 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI26063J44948_10273662 | F023452 | N/A | VKQVKPASIPIAPKKPLIKNNLVLFIFIAARPVNFNIGSITIKANRFRKKTTSRICKFSDAFLTKITIIEKKTIDKIFKIIALV* |
| ⦗Top⦘ |