Scaffold JGI26063J44948_1003598

Overview

Basic Information

• Taxon OID: 3300002965
• Scaffold ID: JGI26063J44948_1003598
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4129
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9728
  • Long. (^o): -44.9905
  • Depth (m): 2502

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038276	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
JGI26063J44948_10035984	F038276	AGTAG	MNLDFLLRLTNYVNNVGTNYLAVIKQFLTVLVIINHACVLLHGNHNYKDVFYDRLSNQYIRNACDFHNLHISCNNLGLVLEKFLLDVKIINNKV*