Scaffold JGI26062J44793_1005882

Overview

Basic Information

• Taxon OID: 3300002955
• Scaffold ID: JGI26062J44793_1005882
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1593
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9951
  • Long. (^o): -44.9972
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002125	Metagenome / Metatranscriptome	591	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26062J44793_10058824	F002125	N/A	AVIALVGEASLTSVDLFVSKDTAKLMFLRKRQQPIIEVQKVNK*