| Basic Information | |
|---|---|
| Taxon OID | 3300002933 Open in IMG/M |
| Scaffold ID | G310J44882_10004277 Open in IMG/M |
| Source Dataset Name | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5186 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050334 | Metagenome | 145 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| G310J44882_100042771 | F050334 | N/A | IWIVANLPKSRGLHREIVSFDEKPLQTPAWRKDLSEFYSTDDFDYLRKLERHQTDPHHWPCPFPPQE* |
| ⦗Top⦘ |