| Basic Information | |
|---|---|
| Taxon OID | 3300002931 Open in IMG/M |
| Scaffold ID | CVPL010W_10082131 Open in IMG/M |
| Source Dataset Name | Ant worker gut metagenome for colony PL010 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Harvard University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 543 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Cephalotes Varians → Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Key Largo, Florida | |||||||
| Coordinates | Lat. (o) | 25.2845833 | Long. (o) | -80.3122167 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059647 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CVPL010W_100821311 | F059647 | N/A | MASTGPV*PVVVNGGQLWSRIPSLNELVHFKAELRDLGLVYQVIASTAL*DKIGQISSK |
| ⦗Top⦘ |