Scaffold Water_104656

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Water_104656

Scaffold Water_104656

Overview

Basic Information
Taxon OID	3300002930 Open in IMG/M
Scaffold ID	Water_104656 Open in IMG/M
Source Dataset Name	Estuary water microbial communities from Pearl Estuary, Zhujiang, China
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2126
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water → Estuary Water Microbial Communities From Pearl Estuary, Zhujiang, China

Source Dataset Sampling Location
Location Name	Pearl Estuary, Zhujiang, China
Coordinates	Lat. (^o)	22.67	Long. (^o)	113.71	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023590	Metagenome / Metatranscriptome	209	N

Sequences

Protein ID	Family	RBS	Sequence
Water_1046563	F023590	N/A	MSITIGNLVALKGGKFADSTATVTGTQATNYIYLVVNADCVFTALTDMADNNVLTNWGLTGKTLKTGMVLAPASGKAFKTVTVASGSVLLIKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.