| Basic Information | |
|---|---|
| Taxon OID | 3300002920 Open in IMG/M |
| Scaffold ID | Pfga_1053862 Open in IMG/M |
| Source Dataset Name | Hot springs microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA-MHS Pond Facies_Gas lift |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7586 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs → Hot Springs Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone Mammoth Hotsprings | |||||||
| Coordinates | Lat. (o) | 44.9766 | Long. (o) | -110.7016 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003471 | Metagenome / Metatranscriptome | 485 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Pfga_10538629 | F003471 | GGAG | MNISNPRSVKQPKSVPVPTCCGYPNNVKATQTVKTRGTGAATRGVRSSTKLG* |
| ⦗Top⦘ |