Scaffold Pfga_1032033

Overview

Basic Information

• Taxon OID: 3300002920
• Scaffold ID: Pfga_1032033
• Source Dataset Name: Hot springs microbial communities from Mammoth Hot Springs, Yellowstone National Park, Wyoming, USA-MHS Pond Facies_Gas lift
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4743
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Springs → Hot Springs Microbial Communities From Mammoth Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone Mammoth Hotsprings
• Coordinates
  • Lat. (^o): 44.9766
  • Long. (^o): -110.7016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028182	Metagenome / Metatranscriptome	192	N

Sequences

Protein ID	Family	RBS	Sequence
Pfga_10320332	F028182	AGG	MPKVSISEAARRLETTEEVIREWIRLGLLDVELPSAKPRRIRELNLAFQPTSATPEPKVDLKQLYEVADQVGWFLLSMEAWDRADTETACQLSHTGTIPPL*