Scaffold JGI26061J44794_1083662

Overview

Basic Information

• Taxon OID: 3300002919
• Scaffold ID: JGI26061J44794_1083662
• Source Dataset Name: Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 555
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -37.9728
  • Long. (^o): -44.9905
  • Depth (m): 5110

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059064	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26061J44794_10836621	F059064	N/A	VLAAASNTQITATPEELNHVDGVTGNIQTALDSKATEAFAIAQAVALG*